Skip to content
brianhigh edited this page Mar 27, 2015 · 25 revisions

Data Files

Data File Types: Binary vs. Plain Text

There are essentially two main categories of digital file types, binary and plain text.

If a file is binary, the file just contains "zeros and ones". While this is technically true of any digital file stored within a binary computer system, the contents of a binary file does not conform to any standard character encoding system. The format may be highly efficient for storage or processing, but is essentially opaque, in that by simply looking at a binary file’s contents, you can’t really know what the format is or how to read it.[1] Examples of binary files are database files, multimedia files, and compressed files (such as zip files).

Plain text files, on the other hand, are composed of characters. Typically they are ASCII or Unicode characters represented by one or more bytes, where a byte is (generally) 8 bits. A bit can be considered either zero (off) or one (on). Plain text file formats are usually open and standard. Examples are web pages (HTML) as well as XML, and CSV (comma separated value) data files.

File Name Extensions

Filenames generally have an extension, which is the part at the end ("suffix") of the filename, consisting of the last dot (.) and the characters that follow it.[2]

Examples of binary filename extensions for images are .png and .jpeg. To launch "executable" programs on Windows systems you will often launch an .exe file. The .dmg ("disk image") filename extension is used on OS X. Common extensions for binary data files are .xls and .sas7bdat.

Plain text file formats for data files include .csv, .tsv, .txt, .xml, and .json, among others. Program source code is usually stored in plain text files, with extensions such as .R, .py, .pl, .c, .sh, .bat, and .do.

The extension is used to determine which "default application" should open it. Within the operating system, the extention is mapped to default applications. Mappings such as these are called file type associations.[3]

Viewing Binary and Plain Text Files

When viewing the raw contents of files, whether they are binary or text files, we will often make use of a hexidecimal dump.

Hexdecimal is a base-16 number system with digits 0-F:

0 1 2 3 4 5 6 7 8 9 A B C D E F

Whereas binary has two possibilities, 0 and 1, hexadecimal has 16, including the ten decimal digits plus the letters a-f.

Let’s "dump" files in "hex" with hexdump

$ hexdump -C -n 64 filename

Where the options we are using is this example are:

  • -C = display in hex and ASCII

  • -n 64 = show the first 64 characters

  • filename = name of file to view

In this example, we will view the first 64 bytes of an SVG image file. The file format stores information about the image in text, even though the file is displayed as a graphical image. Our filename is pie.svg.

$ hexdump -C -n 64 pie.svg
00000000  3c 3f 78 6d 6c 20 76 65  72 73 69 6f 6e 3d 22 31  |<?xml version="1|
00000010  2e 30 22 20 65 6e 63 6f  64 69 6e 67 3d 22 75 74  |.0" encoding="ut|
00000020  66 2d 38 22 3f 3e 0a 3c  21 44 4f 43 54 59 50 45  |f-8"?>.<!DOCTYPE|
00000030  20 73 76 67 20 50 55 42  4c 49 43 20 22 2d 2f 2f  | svg PUBLIC "-//|
00000040

We see a column of numbers on the left which show the character numbers in hexadecimal. Each line shows the hexadecimal number for each of 16 characters, in the center of the output, and on the right is the text equivalent (in "ASCII") of those character numbers.

We can see that this is an "XML" document with a version number, and the character encoding is shown as "UTF-8". The document type ("DOCTYPE") is "svg". All of this is contained in XML tags, similar is structure to HTML (the language of most web pages). The hexadecimal numbers correlate to the ASCII characters because the first 128 characters of the UTF-8 encoding scheme are the same as the ASCII character set. We go into more detail on this matter later in this chapter.

Even if the file was not a text file, and the ASCII printout looked like random characters, we would still be able to look at the hexadecimal dump to lear about the file.

For example, here is the PNG (binary) version of that same image. We will use the same syntax with hexdump, bit look inside the pie.png file.

$ hexdump -C -n 64 pie.png
00000000  89 50 4e 47 0d 0a 1a 0a  00 00 00 0d 49 48 44 52  |.PNG........IHDR|
00000010  00 00 01 2c 00 00 02 26  10 04 00 00 00 13 97 a3  |...,...&........|
00000020  46 00 00 00 04 67 41 4d  41 00 00 b1 8f 0b fc 61  |F....gAMA......a|
00000030  05 00 00 00 20 63 48 52  4d 00 00 7a 26 00 00 80  |.... cHRM..z&...|
00000040

We have the same format of output. On the right, we see that the file is identified[4] as a PNG file, as shown in the first few ASCII characters, but all other ASCII characters appear random (meaningless). Dots are shown for "non-printing" characters. Since the file is binary, and not encoded as characters, the ASCII which has been interpreted by hexdump is not very useful for learning anything more about the image. We will just have to open the image in a graphics viewer to see what it is. Although both image files would display the same, you can see that there is a big difference between the contents of plain text and binary file formats.

Character Encodings

We will now take a closer look at the most popular character encodings for text files.

  • ASCII (7-bit): The best-known standard for text.

  • Extended ASCII (8-bit): The extra bit allows for a few more special symbols.

  • Unicode (1-4 bytes): The current standard.

  • Note: 8 bits per byte

ASCII

Some key points to know about ASCII are:

  • "American Standard Code for Information Interchange"[5]

  • ASCII standard first published in 1963

  • Current version of US ASCII is ANSI X3.4-1986

  • ASCII was internationalized as ISO 646:1983

  • 7-bit character set with 128 characters (2^7 = 128)

ASCII Table

The ascii command prints all 128 ASCII characters.

$ ascii
Usage: ascii [-dxohv] [-t] [char-alias...]
   -t = one-line output  -d = Decimal table  -o = octal table  -x = hex table
   -h = This help screen -v = version information
Prints all aliases of an ASCII character. Args may be chars, C \-escapes,
English names, ^-escapes, ASCII mnemonics, or numerics in decimal/octal/hex.

Dec Hex    Dec Hex    Dec Hex  Dec Hex  Dec Hex  Dec Hex   Dec Hex   Dec Hex
  0 00 NUL  16 10 DLE  32 20    48 30 0  64 40 @  80 50 P   96 60 `  112 70 p
  1 01 SOH  17 11 DC1  33 21 !  49 31 1  65 41 A  81 51 Q   97 61 a  113 71 q
  2 02 STX  18 12 DC2  34 22 "  50 32 2  66 42 B  82 52 R   98 62 b  114 72 r
  3 03 ETX  19 13 DC3  35 23 #  51 33 3  67 43 C  83 53 S   99 63 c  115 73 s
  4 04 EOT  20 14 DC4  36 24 $  52 34 4  68 44 D  84 54 T  100 64 d  116 74 t
  5 05 ENQ  21 15 NAK  37 25 %  53 35 5  69 45 E  85 55 U  101 65 e  117 75 u
  6 06 ACK  22 16 SYN  38 26 &  54 36 6  70 46 F  86 56 V  102 66 f  118 76 v
  7 07 BEL  23 17 ETB  39 27 '  55 37 7  71 47 G  87 57 W  103 67 g  119 77 w
  8 08 BS   24 18 CAN  40 28 (  56 38 8  72 48 H  88 58 X  104 68 h  120 78 x
  9 09 HT   25 19 EM   41 29 )  57 39 9  73 49 I  89 59 Y  105 69 i  121 79 y
 10 0A LF   26 1A SUB  42 2A *  58 3A :  74 4A J  90 5A Z  106 6A j  122 7A z
 11 0B VT   27 1B ESC  43 2B +  59 3B ;  75 4B K  91 5B [  107 6B k  123 7B {
 12 0C FF   28 1C FS   44 2C ,  60 3C <  76 4C L  92 5C \  108 6C l  124 7C |
 13 0D CR   29 1D GS   45 2D -  61 3D =  77 4D M  93 5D ]  109 6D m  125 7D }
 14 0E SO   30 1E RS   46 2E .  62 3E >  78 4E N  94 5E ^  110 6E n  126 7E ~
 15 0F SI   31 1F US   47 2F /  63 3F ?  79 4F O  95 5F _  111 6F o  127 7F DEL

You will see that there is a header showing the command usage followed by an ASCII table listing. The listing is arranged in 8 sets of columns, with each set showing the decimal (Dec) and hexadecimal (Hex) value for each character. Starting from zero (0), the first 32 characters (and the 128th) are the so-called "non-printing" characters, so those are shown with 2-3 letter codes describing the character. The 33rd character is the "Space" so nothing is shown. All other characters are symbols which appear on the standard US keyboard. The punctuation characters and decimal digits are followed by capital letters, more puntuation, lower-case letters, more punctuation, and finally ending with "DEL" (Delete), the 128th character (numbered 127, or 7F in hexadecimal). To have more characters, we would need more bits in our encoding standard, which we will look into next.

Extended ASCII

  • ISO-8859-1 is an 8-bit extension with 191 characters

  • ISO-8859-1 ("ISO Latin 1") was first published in 1987

ISO-8859-1
ISO-8859-1 (Latin1) - Image: Roman Czyborra

Windows Latin 1 (Windows-1252)
  • ISO-8859-1 was extended to Windows-1252

  • Windows-1252 is sometimes (incorrectly) called "ANSI"[6]

Windows-1252
Windows-1252 (WinLatin1) - Image: Roman Czyborra

Why Character Encoding Matters

We can see how differences in character encodings can matter with a few simple examples. Let’s first generate a table of characters with Python.

Example 1. Printing the Windows-1252 character set with Python

The following Python script will show the printable characters of the Windows-1252 character set when run on a Windows system using a graphical Python interpreter such as IDLE or PyScripter.

Windows-1252 Table Python Script
Windows-1252 Table Python Script - Image: Brian High, CC-BY 4.0 International

Here is the full code listing for that Python script.

asciitable.py
# If run on a Windows system in a graphical environment such as
# IDLE's Python Shell, by default, this will print the Windows
# Latin 1 character set, a.k.a. Windows-1252 (WinLatin1).

import sys

# Print Extended ASCII table from character 32 to 256.
# (Skip non-printing characters numbered 1-31.)
start = 32
for i in range(start, 256):
    # Replace each non-printing character with a space.
    if i not in [129, 127, 141, 143, 144, 157, 160]:
        sys.stdout.write(chr(i))
    else:
        sys.stdout.write(" ")
    # Print a newline every 16 characters.
    if i > start and (i + 1) % 16 == 0:
        print
Example 2. Changing the Character Encoding within your application

We can see the characters properly in a non-Windows environment if we specifically set the character encoding in the application.

Changing Character Encoding in Linux Terminal
Changing Character Encoding in Linux Terminal - Image: Brian High, CC-BY 4.0 International

However, this is not the default setting. Without knowing the output was encoded as Windows-1252, we might have thought our program had a bug.

So, how can we know the character encoding of "plain text" output? Let’s save the output as a file and test the file for it’s character encoding.

Example 3. Saving the output to a file with redirection

To save program output as a file, we can use file redirection. We will run the program on the Windows computer in a DOS shell and redirect with the '>' operator.[7]

C:\> python asciitable.py > asciitable.txt

Redirection allows us to save to a file, but that file just contains the numeric codes for the characters. There is nothing in the file stating the actual character encoding format. We will have to guess, using the file command.

Example 4. Testing the file type with file

We can check the character encoding and other file properties using the file command. This command is available on Unix, Linux, and OS X systems. Here we will run the file command from a Bash shell.

$ file asciitable.txt
asciitable.txt: Non-ISO extended-ASCII text, with CRLF, NEL line terminators

While this tells us a little about the text format, we still don’t know the specific encoding standard used.

As you can see, dealing with various character encodings on different computing systems can be tricky. Is there a universal character encoding standard? Yes, Unicode! In the next section, we’ll see how we can convert our file to Unicode.[8]

Unicode

Unicode provides an internationalized character encoding standard, to "encompass the characters of all the world’s living languages".[9]

  • Like ASCII, but supports over 110,000 characters

  • Unicode standard was published in 1991

  • Most commonly used encodings are UTF-8 and UTF-16[10]

You can browse the Unicode code charts to get an idea of the many character sets available.

Unicode Symbol Example: the Micro Sign
Example 5. Encoding the Micro Sign

The character µ, with Unicode[11] name "MICRO SIGN" is encoded:

Encodings Decimal Hex

Unicode

181

U+00B5

Extended ASCII

181

B5

HTML numeric character reference

&#181;

&#xB5;

HTML named character entity

&micro;

Example 6. Typing the Micro Sign

How do you type the µ character into your computer?

Use these character codes:

Name Decimal Hex

MICRO SIGN

181

00B5

With these operating systems:[12]

  • Windows: [Alt]decimal (using numeric keypad) … orhex[Alt][x] (does not require numeric keypad)

  • OS X: for µ, you can simply use [Opt][m] … or … [Command][Ctrl][Space] … Search by nameor … use Unicode Hex Input (Input Source) and hex

  • Linux: [Shift][Ctrl]hex

Some Other Useful Symbols
Table 1. HTML Entities for Common Math Symbol Characters
Character Name Char. Entity Num. Entity Hex. Entity

DEGREE SYMBOL

°

&deg;

&#176;

&#xB0;

MICRO MU SYMBOL

µ

&micro;

&#181;

&#xB5;

LOWER CASE SIGMA

σ

&sigma;

&#963;

&#x3C3;

N-ARY SUMMATION

&sum;

&#8721;

&#x2211;

GREEK SMALL LETTER PI

π

&pi;

&#960;

&#x3C0;

GREEK SMALL LETTER ALPHA

α

&alpha;

&#945;

&#x3B1;

GREEK SMALL LETTER BETA

β

&beta;

&#946;

&#x3B2;

GREEK SMALL LETTER GAMMA

γ

&gamma;

&#947;

&#x3B3;

INCREMENT

Δ

&Delta;

&#8710;

&#x2206;

GREEK SMALL LETTER EPSILON

ε

&epsilon;

&#949;

&#x3B5;

INFINITY

&infin;

&#8734;

&#x221E;

PLUS OR MINUS

±

&plusmn;

&#177;

&#xB1;

NOT EQUALS

&ne;

&#8800;

&#x2260;

ALMOST EQUAL

&asymp;

&#8776;

&#x2248;

GREATER THAN OR EQUAL TO

&ge;

&#8805;

&#x2265;

LESS THAN OR EQUAL TO

&le;

&#8804;

&#x2264;

DIVISION SIGN

÷

&divide;

&#247;

&#xF7;

SUPERSCRIPT TWO

²

&sup2;

&#178;

&#xB2;

SUPERSCRIPT THREE

³

&sup3;

&#179;

&#xB3;

For example, in Windows, you can use the "Num. Entity" column for [Alt] codes such as [Alt]946 for β (beta).

UTF-8: Encoding the Unicode Code Space

  • UTF-8 (1993) is a variable-length 8-bit character encoding

  • A UTF-8 character will use one to four 8-bit bytes

  • ASCII characters are the first 128 characters of UTF-8

  • Use of UTF-8 surpassed ASCII on the Web in Dec. 2007

  • UTF-8 is the default encoding for HTML5 and JSON

UTF-8 and UTF-16 are the standard encodings for Unicode text in HTML documents, with UTF-8 as the preferred and most used encoding.[13]

— Wikipedia
UTF-8
Character Encoding Conversion Example

We can convert a file encoded as Windows-1252 into UTF-8 with iconv.[14]

Example 7. Converting a Windows-1252 file into UTF-8
$ iconv -f windows-1252 -t utf-8 asciitable.txt > asciitable2.txt
$ file asciitable2.txt
asciitable2.txt: UTF-8 Unicode text

As you can see, you can use file to verify that this is a Unicode file encoded as UTF-8.

Tip
"Normalize" text datafiles to a common, universal encoding format like UTF-8 to ensure characters are displayed with the intended symbols.

Data Structure

XML

XML
XML - Image: Dreftymac, CC BY 2.5

JSON

  • JavaScript Object Notation

  • Open format (ISO and ECMA standards)

  • Human-readable text

  • For transmiting data objects

  • Attribute–value pairs

  • Often used in Ajax web applications

Example 8. JSON data structure for a person (John Smith)[16]
{
  "firstName": "John",
  "lastName": "Smith",
  "isAlive": true,
  "age": 25,
  "height_cm": 167.6,
  "address": {
    "streetAddress": "21 2nd Street",
    "city": "New York",
    "state": "NY",
    "postalCode": "10021-3100"
  },
  "phoneNumbers": [
    {
      "type": "home",
      "number": "212 555-1234"
    },
    {
      "type": "office",
      "number": "646 555-4567"
    }
  ],
  "children": [],
  "spouse": null
}

Delimited Text Files

Files formated with delimiter separated values use:

  • Comma (e.g., "CSV")

  • Tab (e.g., "TSV")

  • Pipe (vertical bar: |)

… or other single character as a separator between values.

The records (rows) are separated by line-ending characters (newlines):

  • Carriage-return (CR)

  • Line-feed (LF)

  • Carriage-return, Line-feed (CRLF)

Fixed-Width Text Files

  • Text files arranged in neatly formatted columns

  • Space filled with varying numbers of spaces or tabs

  • Easier to look at, but a little harder to parse

  • Lines are separated with newlines

                   mpg cyl disp
Mazda RX4         21.0   6  160
Mazda RX4 Wag     21.0   6  160
Datsun 710        22.8   4  108
Hornet 4 Drive    21.4   6  258
Hornet Sportabout 18.7   8  360
Valiant           18.1   6  225

(Data from mtcars, The R Datasets Package, R Core Team.)[17]


Multi-line Text Files

Some popular genomics file formats use multi-line records.

>gi|5524211|gb|AAD44166.1| cytochrome b [Elephas maximus maximus]
LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV
EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG
LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL
GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX
IENY
@SRR001666.1 071112_SLXA-EAS1_s_7:5:1:817:345 length=36
GGGTGATGGCCGCTGCCGATGGCGTCAAATCCCACC
+SRR001666.1 071112_SLXA-EAS1_s_7:5:1:817:345 length=36
IIIIIIIIIIIIIIIIIIIIIIIIIIIIII9IG9IC

Data File Layout: Tidy Data

Structure data files as simple "columns and rows" …

subID height weight

1

58

115

2

59

117

3

60

120

… to make them easier to import and analyze.

(Data from women, The R Datasets Package, R Core Team.)[20]


The basic tenets of tidy data are:[21]

  • Each variable forms a column.

  • Each observation forms a row.

  • Each type of observational unit forms a table

Data File Layout: Tidy Data

Is this spreadsheet[22] tidy data or not? Why or why not?

spreadsheet

Wide and Long: Which Table is Tidier?

Table 2. Iris data in "wide" format
Sepal.Length Sepal.Width Petal.Length Petal.Width Species

5.1

3.5

1.4

0.2

setosa

5.7

2.8

4.1

1.3

versicolor

Table 3. Iris data in "long" format
Flower.Id Species Flower.Part Length Width

1

setosa

Petal

1.4

0.2

1

setosa

Sepal

5.1

3.5

100

versicolor

Petal

4.1

1.3

100

versicolor

Sepal

5.7

2.8

(Data from iris, The R Datasets Package, R Core Team.)[23] '''

Why does tidiness matter?

Now we can "facet" a plot by Species and Flower.Part.

ggplot(data=iris, aes(x=Width, y=Length)) +
    geom_point() + facet_grid(Species ~ Flower.Part, scale="free") +
    geom_smooth(method="lm") + theme_bw(base_size=16)
Plot using tidy iris data
Plot using tidy iris data - Image: Brian High, CC-BY 4.0 International


1. Actually, byte sequences called magic numbers or file signatures may be used to identify file formats, but their use is not completely standardised or universal.
2. Filename extension, Wikipedia, CC BY-SA 3.0
3. file association, Wikipedia, CC BY-SA 3.0
4. The first few bytes of a file are often used to identify the file type.
6. Windows-1252, Wikipedia, CC BY-SA 3.0
7. We would use the same python command from the Bash shell in Unix, Linux, or OS X.
8. For a more thorough treatment of dealing with character encoding problems, see "Bad Data Lurking in Plain Text" by Josh Levy, PhD, which is the fourth chapter of Q. Ethan McCallum’s Bad Data Handbook (O’Reilly Media, Inc., 2012).
9. Joe Becker, Unicode 88
12. Unicode input, Wikipedia, CC BY-SA 3.0
14. iconv is another tool originally developed for Unix, Linux and OS X systems, though Windows versions are available and can be found with an Internet search.
17. Extracted from the 1974 Motor Trend US magazine. Source: Henderson and Velleman (1981), Building multiple regression models interactively. Biometrics, 37, 391–411.
18. FASTA format, Wikipedia, CC BY-SA 3.0
19. FASTQ format, Wikipedia, CC BY-SA 3.0
20. The World Almanac and Book of Facts, 1975. Reference: McNeil, D. R. (1977) Interactive Data Analysis. Wiley.
21. Hadley Wickham, Tidy Data
22. WHO
23. Anderson, Edgar (1935). The irises of the Gaspe Peninsula, Bulletin of the American Iris Society, 59, 2–5. Reference: Fisher, R. A. (1936) The use of multiple measurements in taxonomic problems. Annals of Eugenics, 7, Part II, 179–188.